UPSP:ACOX_YEAST (POX1)

demo
RunMM_clICAT12.pep.xml (Peroxisomal_ICAT/MM_clICAT12 (Native_Yeast_ICAT))
Sequence Mass84,042 
AA Coverage8% (57 / 748)
Mass Coverage7% (6,224 / 84,042)
Peptides?
0102030405060708090
MTRRTTINPDSVVLNPQKFIQKERADSKIKVDQVNTFLESSPERRTLTHALIDQIVNDPILKTDTDYYDAKKMQEREITAKKIARLASYMEHDIKTVRKH
100110120130140150160170180190
FRDTDLMKELQANDPDKASPLTNKDLFIFDKRLSLVANIDPQLGTRVGVHLGLFGNCIKGNGTDEQIRYWLQERGATLMKGIYGCFAMTELGHGSNVAQL
200210220230240250260270280290
QTRAVYDKQNDTFVIDTPDLTATKWWIGGAAHSATHAAVYARLIVEGKDYGVKTFVVPLRDPSTFQLLAGVSIGDIGAKMGRDGIDNGWIQFRNVVIPRE
300310320330340350360370380390
FMLSRFTKVVRSPDGSVTVKTEPQLDQISGYSALLSGRVNMVMDSFRFGSKFATIAVRYAVGRQQFAPRKGLSETQLIDYPLHQYRVLPQLCVPYLVSPV
4 / 2(C') >>
400410420430440450460470480490
AFKLMDNYYSTLDELYNASSSAYKAALVTVSKKLKNLFIDSASLKATNTWLIATLIDELRQTCGGHGYSQYNGFGKGYDDWVVQCTWEGDNNVLSLTSAK
> 1 / 1(C') / 1(Q^) 3 / 2(C')
500510520530540550560570580590
SILKKFIDSATKGRFDNTLDVDSFSYLKPQYIGSVVSGEIKSGLKELGDYTEIWSITLIKLLAHIGTLVEKSRSIDSVSKLLVLVSKFHALRCMLKTYYD
600610620630640650660670680690
KLNSRDSHISDEITKESMWNVYKLFSLYFIDKHSGEFQQFKIFTPDQISKVVQPQLLALLPIVRKDCIGLTDSFELPDAMLNSPIGYFDGDIYHNYFNEV
700710720730740
CRNNPVEADGAGKPSYHALLSSMLGRGFEFDQKLGGAANAEILSKINK
Peptide Filter:(SeqId = 283571) AND (SeqId = 283571)
Peptide Sort:
Peptide Counts:8 total, 3 distinct
SeqId = 283571
12642+27.00019.1008.6009.6000.01433%1922.8970+1.50200.9851R.Q^TC'GGHGYSQYNGFGK.G1UPSP:ACOX_YEAST
28093+41.70022.40010.80012.0000.00720%2936.4250+0.6770-3.0000K.GYDDWVVQC'TWEGDNNVLSLTSAK.S1UPSP:ACOX_YEAST
31782+41.20015.7007.90011.7000.00028%2936.4250+1.21800.9999K.GYDDWVVQC'TWEGDNNVLSLTSAK.S1UPSP:ACOX_YEAST
31842+39.70015.4008.70011.7000.00028%2927.4250+0.87500.9998K.GYDDWVVQCTWEGDNNVLSLTSAK.S1UPSP:ACOX_YEAST
34642+22.70010.7006.2009.8000.06525%2109.2660+1.36800.9904R.VLPQLC'VPYLVSPVAFK.L1UPSP:ACOX_YEAST
34652+29.20014.8006.40011.2000.03631%2100.2660+1.36300.9919R.VLPQLCVPYLVSPVAFK.L1UPSP:ACOX_YEAST
35552+23.60012.0008.50010.5000.00925%2109.2660+1.64100.9970R.VLPQLC'VPYLVSPVAFK.L1UPSP:ACOX_YEAST
35562+28.50015.2008.50011.2000.02031%2100.2660+1.69300.9936R.VLPQLCVPYLVSPVAFK.L1UPSP:ACOX_YEAST