UPSP:TCB1_YEAST (TCB1)

demo
RunMM_clICAT12.pep.xml (Peroxisomal_ICAT/MM_clICAT12 (Native_Yeast_ICAT))
Sequence Mass133,576 
AA Coverage1% (9 / 1,186)
Mass Coverage1% (1,025 / 133,576)
Peptides?
0102030405060708090
MAKEDTGVTAPKKPETAQVANINGIDKLEPPKTKEETESSKSVSSEKAAHASDESFKRSIHEASYVGWKQIGGWEDKDELTLDDELMDMTRETFLDNIIP
100110120130140150160170180190
DSLYGDWYHSVAIFFIGGVASFALGHYKFSMGSAFFVIVITSLLYRTSAKKYRGSIRELVQKEFTVQKVENDYESLEWLNAFLDKYWPILEPSVSQLIVQ
200210220230240250260270280290
QANEQMATNEAIPKFITQLWIDELTLGVKPPRVDLVKTFQNTASDVVVMDWGISFTPHDLCDMSAKQVRNYVNELAVVKAKIFGITIPVSVSDIAFKAHA
300310320330340350360370380390
RVKFKLMTPFPHVETVNIQLLKVPDFDFVATLFGRSIFNWEILAIPGLMTLIQKMAKKYMGPILLPPFSLQLNIPQLLSGSNLSIGILEITVKNAKGLKR
400410420430440450460470480490
TSSILNESIDPYLSFEFNDISIAKTRTVRDTLNPVWDETLYVLLNSFTDPLTISVYDKRAKLKDKVLGRIQYNLNTLHDKTTQRNLKAQFLRNSKPVGEL
500510520530540550560570580590
TFDLRFFPTLEEKKLPDGSVEELPDLNTGIAKVVVEEGSRFAEEEQKVTAYVEVYLNAKLVLTTGKATDTGTLKWNSDYEAVIADRRKTRYKFVVKDGKG
600610620630640650660670680690
EEIGSTIQTLNDLIDRSQVNKNLIPLKNQKGDIKITTYWRPVRLEIGSNSVAYTPPIGAIRVFIEKANDLRNLEKFGTIDPYCKVLVNGLSKGRTDFKSQ
1
700710720730740750760770780790
TLNPVWNQVIYVAVTSPNQRITLQCMDVETVNKDRSLGEFNVNVQDLFKKDENDKYEETIDEKAKVGRLVMPKKKPKGTITYYTSFYPALPVLTLEEIQD
800810820830840850860870880890
LDKVNKKKKALELRKSAIDEKKISKEDKAKFDQEWNEVKELEDMYSNRQKLDLPELLQYNQGVLAVTVLNGELPDSGLYVQAFFDDNGHPRFVSPRIPSR
900910920930940950960970980990
IVKNGWSGDVIIKELDKSITTFRVAKNKNYNRVEKCVCEVELPTQELVKNCYYKPSILHLSGEGSAKLMLQISWFPIDTKQLPANDLITNSGDLTIMSRS
1000101010201030104010501060107010801090
AENLIASDLNGYSDPYLKYYINNEEDCAYKTKVVKKTLNPKWNDEGTIQINNRLNDVLRIKVMDWDSTSADDTIGTAEIPLNKVKVEGTTELDVPVEGLE
110011101120113011401150116011701180
NAGQDGGMLHLAFSFKPRYTISVSKREKKVGDIASKGLGTGLKAGTTVIGGGVGAIGKIKKGVFGGLGSLTNHKKNHEMGEEETKF
Peptide Filter:(SeqId = 281530) AND (SeqId = 281530)
Peptide Sort:
Peptide Counts:1 total, 1 distinct
SeqId = 281530
15241+31.60015.2006.20013.6000.00163%1270.6870+0.36301.0000K.FGTIDPYCK.V1UPSP:TCB1_YEAST