UPSP:RHO1_YEAST (RHO1)

demo
RunMM_clICAT13.pep.xml (Peroxisomal_ICAT/MM_clICAT13 (k_Yeast_ICAT))
Sequence Mass23,152 
AA Coverage5% (11 / 209)
Mass Coverage4% (1,013 / 23,152)
Peptides?
0102030405060708090
MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENV
3 / 2(C')
100110120130140150160170180190
QEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTNGKAKKNTTE
200
KKKKKCVLL
Peptide Filter:(SeqId = 279316)
Peptide Sort:
Peptide Counts:3 total, 1 distinct
12941+342.000252.0000.0001.0000.03765%1267.7550+0.41000.9951K.LVIVGDGAC'GK.T1UPSP:RHO1_YEAST
12962+600.000396.0001.0001.0000.00285%1267.7550+1.42200.9995K.LVIVGDGAC'GK.T1UPSP:RHO1_YEAST
12991+309.000216.0000.0001.0000.02545%1258.7550+0.51200.9822K.LVIVGDGACGK.T1UPSP:RHO1_YEAST