UPSP:COX4_YEAST (COX4)

demo
RunMM_clICAT13.pep.xml (Peroxisomal_ICAT/MM_clICAT13 (k_Yeast_ICAT))
Sequence Mass17,143 
AA Coverage6% (9 / 155)
Mass Coverage6% (1,056 / 17,143)
Peptides?
0102030405060708090
MLSLRQSIRFFKPATRTLCSSRYLLQQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIII
100110120130140150
ESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH
1 / 1(C')
Peptide Filter:(SeqId = 279989)
Peptide Sort:
Peptide Counts:1 total, 1 distinct
14372+304.000218.0000.0001.0000.52063%1546.8380+0.51400.9433R.C'WEC'GSVYK.L1UPSP:COX4_YEAST