UPSP:YL290_YEAST (YL290_YEAST)

demo
RunMM_clICAT13.pep.xml (Peroxisomal_ICAT/MM_clICAT13 (k_Yeast_ICAT))
Sequence Mass31,524 
AA Coverage6% (17 / 277)
Mass Coverage6% (1,808 / 31,524)
Peptides?
0102030405060708090
MIPKLIVFGGNGFLGKRICQEAVTSGYQVVSVSRSGKAPHSNELNDKQWMQEVQWTAADIFKPDSYHELLNNATNVVHSLGILLENENYKQTLSKSPTYD
1 / 1(C')
100110120130140150160170180190
SKSRLLSFGAGPNPLKKSSPYFTYEMMNKQSAIILADTFKQKILKKSKKEQEKANQRSFTYISADKGFPLIPSGYINSKREAEIELEKMQRYFRPIIVRP
200210220230240250260270
GFMFDEHRNAIGPRSFIHTALELLYCGNKFLLRNKLQLLNDLIRPTVSTQQVSKSVLKNIENPDFKGVVTLEEILKA
Peptide Filter:(SeqId = 280522)
Peptide Sort:
Peptide Counts:1 total, 1 distinct
17712+524.000223.0001.0002.0000.00072%2062.1110+1.12400.9998R.IC'QEAVTSGYQVVSVSR.S1UPSP:YL290_YEAST