UPSP:PDR15_YEAST (PDR15)

demo
RunMM_clICAT13.pep.xml (Peroxisomal_ICAT/MM_clICAT13 (k_Yeast_ICAT))
Sequence Mass172,256 
AA Coverage4% (55 / 1,529)
Mass Coverage3% (5,969 / 172,256)
Peptides?
0102030405060708090
MSSDIRDVEERNSRSSSSSSSSNSAAQSIGQHPYRGFDSEAAERVHELARTLTSQSLLYTANSNNSSSSNHNAHNADSRSVFSTDMEGVNPVFTNPDTPG
100110120130140150160170180190
YNPKLDPNSDQFSSTAWVQNMANICTSDPDFYKPYSLGCVWKNLSASGDSADVSYQSTFANIVPKLLTKGLRLLKPSKEEDTFQILKPMDGCLNPGELLV
200210220230240250260270280290
VLGRPGSGCTTLLKSISSNSHGFKIAKDSIVSYNGLSSSDIRKHYRGEVVYNAESDIHLPHLTVYQTLFTVARMKTPQNRIKGVDREAYANHVTEVAMAT
300310320330340350360370380390
YGLSHTRDTKVGNDLVRGVSGGERKRVSIAEVAICGARFQCWDNATRGLDSATALEFIRALKTQADIGKTAATVAIYQCSQDAYDLFDKVCVLDDGYQLY
1 1 / 1(C')
400410420430440450460470480490
FGPAKDAKKYFQDMGYYCPPRQTTADFLTSITSPTERIISKEFIEKGTRVPQTPKDMAEYWLQSESYKNLIKDIDSTLEKNTDEARNIIRDAHHAKQAKR
500510520530540550560570580590
APPSSPYVVNYGMQVKYLLIRNFWRMKQSASVTLWQVIGNSVMAFILGSMFYKVMKKNDTSTFYFRGAAMFFAILFNAFSCLLEIFSLYETRPITEKHRT
600610620630640650660670680690
YSLYHPSADAFASVLSEMPPKLITAVCFNIIFYFLVDFRRNGGVFFFYFLINVIATFTLSHLFRCVGSLTKTLQEAMVPASMLLLAISMYTGFAIPKTKI
700710720730740750760770780790
LGWSIWIWYINPLAYLFESLMINEFHDRRFPCAQYIPAGPAYQNITGTQRVCSAVGAYPGNDYVLGDDFLKESYDYEHKHKWRGFGIGMAYVVFFFFVYL
800810820830840850860870880890
ILCEYNEGAKQKGEMVVFLRSKIKQLKKEGKLQEKHRPGDIENNAGSSPDSATTEKKILDDSSEGSDSSSDNAGLGLSKSEAIFHWRDLCYDVPIKGGQR
3 / 2(C')
900910920930940950960970980990
RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGRLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEKNRY
1 / 1(C')
1000101010201030104010501060107010801090
VEEVIKILEMQQYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTAWDTCQLMRKLATHGQAILCTIHQPSAILMQQFDRLLFLQ
1100111011201130114011501160117011801190
KGGQTVYFGDLGEGCKTMIDYFESKGAHKCPPDANPAEWMLEVVGAAPGSHATQDYNEVWRNSDEYKAVQEELDWMEKNLPGRSKEPTAEEHKPFAASLY
1 / 1(C')
1200121012201230124012501260127012801290
YQFKMVTIRLFQQYWRSPDYLWSKFILTIFNQVFIGFTFFKADRSLQGLQNQMLSIFMYTVIFNPILQQYLPSFVQQRDLYEARERPSRTFSWLAFFLSQ
1300131013201330134013501360137013801390
IIVEIPWNILAGTIAYCIYYYAVGFYANASAAGQLHERGALFWLFSIAFYVYIGSMGLLMISFNEVAETAAHMGTLLFTMALSFCGVMATPKVMPRFWIF
1400141014201430144014501460147014801490
MYRVSPLTYMIDALLALGVANVDVKCSNYEMVKFTPPSGTTCGDYMASYIKLAGTGYLSDPSATDICSFCAVSTTNAFLATFSSHYYRRWRNYGIFICYI
150015101520
AFDYIAATFLYWLSRVPKKNGKISEKPKK
Peptide Filter:(SeqId = 281793)
Peptide Sort:
Peptide Counts:7 total, 5 distinct
13502+415.000330.0000.0001.0000.26063%1376.6890+0.54500.9759R.FQC'WDNATR.G3UPSP:PDR15_YEAST
18651+322.000226.0001.0001.0000.67069%1292.7290+0.31200.9961R.DLCYDVPIK.G1UPSP:PDR15_YEAST
18662+360.000316.0001.0001.0000.32069%1301.7290+1.23700.8935R.DLC'YDVPIK.G1UPSP:PDR15_YEAST
18671+281.000247.0000.0001.0001.10063%1301.7290+0.20900.9568R.DLC'YDVPIK.G1UPSP:PDR15_YEAST
19472+500.000500.0001.0002.0000.00071%1766.8890+1.77300.9273K.GGQTVYFGDLGEGC'K.T1UPSP:PDR15_YEAST
20011+322.000200.0000.0001.0000.02464%1415.8405-0.00200.9978R.VSIAEVAICGAR.F1UPSP:PDR15_YEAST
23162+391.000271.0000.0001.0000.01972%1370.7820+1.40400.9951K.TTLLDC'LAER.V3UPSP:PDR15_YEAST