UPSP:UAF30_YEAST (UAF30)

demo
RunMM_clICAT13.pep.xml (Peroxisomal_ICAT/MM_clICAT13 (k_Yeast_ICAT))
Sequence Mass25,967 
AA Coverage5% (12 / 228)
Mass Coverage5% (1,352 / 25,967)
Peptides?
0102030405060708090
MAELNDYSTMIDILLSDMDLETVTTKKVRMALKEVYAIDVESQGKAINKLIRKHLDLVKERPRFERSLEDLLKENATLAIELTKEITVSKRSSGEEKNDS
100110120130140150160170180190
ETKGTHVEKKKGTVSKSPISTRKVTLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGKSTNMFEMHKILASHMTEPKKIS
<
200210220
DCPPLIQEVRRKEKPIVSDSEQSDTKGI
<< 1 / 1(C')
Peptide Filter:(SeqId = 282213)
Peptide Sort:
Peptide Counts:1 total, 1 distinct
18262+313.000281.0001.0001.0002.20036%1605.9140+1.84500.6720K.ISDC'PPLIQEVR.R1UPSP:UAF30_YEAST