UPSP:FOX2_YEAST (FOX2)

demo
RunMM_clICAT13.pep.xml (Peroxisomal_ICAT/MM_clICAT13 (k_Yeast_ICAT))
Sequence Mass98,703 
AA Coverage5% (44 / 900)
Mass Coverage5% (4,615 / 98,703)
Peptides?
0102030405060708090
MPGNLSFKDRVVVITGAGGGLGKVYALAYASRGAKVVVNDLGGTLGGSGHNSKAADLVVDEIKKAGGIAVANYDSVNENGEKIIETAIKEFGRVDVLINN
100110120130140150160170180190
AGILRDVSFAKMTEREFASVVDVHLTGGYKLSRAAWPYMRSQKFGRIINTASPAGLFGNFGQANYSAAKMGLVGLAETLAKEGAKYNINVNSIAPLARSR
200210220230240250260270280290
MTENVLPPHILKQLGPEKIVPLVLYLTHESTKVSNSIFELAAGFFGQLRWERSSGQIFNPDPKTYTPEAILNKWKEITDYRDKPFNKTQHPYQLSDYNDL
300310320330340350360370380390
ITKAKKLPPNEQGSVKIKSLCNKVVVVTGAGGGLGKSHAIWFARYGAKVVVNDIKDPFSVVEEINKLYGEGTAIPDSHDVVTEAPLIIQTAISKFQRVDI
400410420430440450460470480490
LVNNAGILRDKSFLKMKDEEWFAVLKVHLFSTFSLSKAVWPIFTKQKSGFIINTTSTSGIYGNFGQANYAAAKAAILGFSKTIALEGAKRGIIVNVIAPH
500510520530540550560570580590
AETAMTKTIFSEKELSNHFDASQVSPLVVLLASEELQKYSGRRVIGQLFEVGGGWCGQTRWQRSSGYVSIKETIEPEEIKENWNHITDFSRNTINPSSTE
3 / 3(C')
600610620630640650660670680690
ESSMATLQAVQKAHSSKELDDGLFKYTTKDCILYNLGLGCTSKELKYTYENDPDFQVLPTFAVIPFMQATATLAMDNLVDNFNYAMLLHGEQYFKLCTPT
1 / 1(C') <
700710720730740750760770780790
MPSNGTLKTLAKPLQVLDKNGKAALVVGGFETYDIKTKKLIAYNEGSFFIRGAHVPPEKEVRDGKRAKFAVQNFEVPHGKVPDFEAEISTNKDQAALYRL
<< 6 / 5(C')
800810820830840850860870880890
SGDFNPLHIDPTLAKAVKFPTPILHGLCTLGISAKALFEHYGPYEELKVRFTNVVFPGDTLKVKAWKQGSVVVFQTIDTTRNVIVLDNAAVKLSQAKSKL
Peptide Filter:(SeqId = 283603)
Peptide Sort:
Peptide Counts:10 total, 3 distinct
12142+389.000270.0001.0001.0000.14054%1598.8760-1.00400.9657K.LC'TPTMPSNGTLK.T1UPSP:FOX2_YEAST
13102+298.000210.0001.0001.0000.29046%1598.8760+0.68600.9460K.LC'TPTMPSNGTLK.T1UPSP:FOX2_YEAST
13622+227.000182.0000.0001.0004.00033%1598.8760+1.34800.4622K.LC'TPTMPSNGTLK.T1UPSP:FOX2_YEAST
15742+385.000271.0000.0001.0000.03267%1598.8760+1.33100.9939K.LC'TPTMPSNGTLK.T1UPSP:FOX2_YEAST
15812+356.000252.0000.0001.0000.51063%1589.8760+1.49200.9898K.LCTPTMPSNGTLK.T1UPSP:FOX2_YEAST
15921+298.000220.0000.0001.0000.04063%1598.8760-0.05100.9937K.LC'TPTMPSNGTLK.T1UPSP:FOX2_YEAST
25233+430.000354.0001.0001.0000.46052%2043.0960+0.5290-3.0000R.VIGQLFEVGGGWC'GQTR.W1UPSP:FOX2_YEAST
26743+446.000383.0001.0001.0000.74050%1972.1230+1.6900-3.0000K.DC'ILYNLGLGC'TSK.E1UPSP:FOX2_YEAST
27742+478.000263.0001.0001.0000.00272%2043.0960+1.53200.9995R.VIGQLFEVGGGWC'GQTR.W1UPSP:FOX2_YEAST
27803+686.000396.0001.0002.0000.00159%2043.0960+0.8470-3.0000R.VIGQLFEVGGGWC'GQTR.W1UPSP:FOX2_YEAST