UPSP:GLYC_YEAST (SHM2)

demo
RunMM_clICAT13.pep.xml (Peroxisomal_ICAT/MM_clICAT13 (k_Yeast_ICAT))
Sequence Mass52,218 
AA Coverage2% (11 / 469)
Mass Coverage2% (1,121 / 52,218)
Peptides?
0102030405060708090
MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTSTSVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD
100110120130140150160170180190
KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRKISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI
1 / 1(C')
200210220230240250260270280290
DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI
300310320330340350360370380390
AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMVLVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT
400410420430440450460
TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDVLNTWKKEIYDWAGEYPLAV
Peptide Filter:(SeqId = 284596)
Peptide Sort:
Peptide Counts:1 total, 1 distinct
12551+234.000190.0000.0001.0001.30055%1375.7880+0.21100.9750K.VLVAGTSAYC'R.L1UPSP:GLYC_YEAST