UPSP:LAS1_YEAST (LAS1)

demo
RunMM_clICAT13.pep.xml (Peroxisomal_ICAT/MM_clICAT13 (k_Yeast_ICAT))
Sequence Mass59,351 
AA Coverage3% (14 / 502)
Mass Coverage3% (1,520 / 59,351)
Peptides?
0102030405060708090
MIPPRIVPWRDFAELEELKLWFYPKSKGTIEDKRQRAVQRVQSYRLKGSQYLPHVVDSTAQITCAVLLDEKEACLGVHQDSIPIRLSYVMALIRFVNGLL
1 / 1(C') / 1(E^)
100110120130140150160170180190
DPTQQSQFAIPLHTLAAKIGLPSWFVDLRHWGTHERDLPGLEMLRWAANEALSWLYDHYWNDEELEDDRDDDDDDDDTGYGYRRNDKLEKYMESLTKTLD
200210220230240250260270280290
KWKRLRNEFLEYKWVWENANDSLITSSNFSGDNLVNYDAEKRKSSHASSSETMIRENLRQWQELWKLSIYHNVVLEKFFNNYDPLLLKVLMLNLNNFDWK
300310320330340350360370380390
VIEWVARNYRTQQDDSNITTILKRKFNAWKELQKRLLDVIINNLNNKNFKNKWQNWEKLIDENASYLILYFCQSMLAKLETEKITGNSWRNKKRRKQIDS
400410420430440450460470480490
TVEIEAKLKENIDNLSLRFNEGEIKLYDFIPAEKDSVPLKKEVSPALKADTNDILGDLASLKQRMSSFGTVGKKNKQEENRATPVKNWSRVQNWKPKPFG
500
VL
Peptide Filter:(SeqId = 285020)
Peptide Sort:
Peptide Counts:1 total, 1 distinct
18472+263.000214.0001.0000.0001.50035%1755.9690-0.13200.3378K.E^AC'LGVHQDSIPIR.L1UPSP:LAS1_YEAST