UPSP:SPS19_YEAST (SPS19)

demo
RunMM_clICAT12.pep.xml (Peroxisomal_ICAT/MM_clICAT12 (Native_Yeast_ICAT))
Sequence Mass31,109 
AA Coverage9% (25 / 292)
Mass Coverage8% (2,489 / 31,109)
Peptides?
0102030405060708090
MNTANTLDGKFVTEGSWRPDLFKGKVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIANVDVRNFEQVENAVKKTV
2 / 1(C') 4 / 2(C')
100110120130140150160170180190
EKFGKIDFVIAGAAGNFVCDFANLSPNAFKSVVDIDLLGSFNTAKACLKELKKSKGSILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIR
200210220230240250260270280290
SNCIAPGAIDNTEGLKRLAGKKYKEKALAKIPLQRLGSTRDIAESTVYIFSPAASYVTGTVLVVDGGMWHLGTYFGHELYPEALIKSMTSKL
Peptide Filter:(SeqId = 279405)
Peptide Sort:
Peptide Counts:6 total, 2 distinct
16041+26.10014.9002.1007.6000.00538%1487.8510+0.20400.9999K.VAFVTGGAGTIC'R.V1UPSP:SPS19_YEAST
16071+26.40012.9005.0008.2000.00242%1478.8510+0.37301.0000K.VAFVTGGAGTICR.V1UPSP:SPS19_YEAST
18762+17.70013.2005.8007.7000.57032%1509.9180-1.34500.3425R.VQTEALVLLGC'K.A1UPSP:SPS19_YEAST
22501+29.00018.7009.00011.7000.02745%1509.9184+0.00500.9998R.VQTEALVLLGC'K.A1UPSP:SPS19_YEAST
22541+47.20018.5008.80012.4000.00068%1500.9180+0.15101.0000R.VQTEALVLLGCK.A1UPSP:SPS19_YEAST
22602+38.70016.3009.40011.5000.00059%1500.9180+1.91801.0000R.VQTEALVLLGCK.A1UPSP:SPS19_YEAST