UPSP:YB96_YEAST (YB96_YEAST)

demo
RunMM_clICAT12.pep.xml (Peroxisomal_ICAT/MM_clICAT12 (Native_Yeast_ICAT))
Sequence Mass43,308 
AA Coverage2% (7 / 387)
Mass Coverage2% (833 / 43,308)
Peptides?
0102030405060708090
MDSIQESDVLNAVKTKLPPCCLRIFRNKIILVGTYDLDKSTGYRSGSLDVFTMDLKLLCSNNTYGAILDLKLSPFDDTLICTAHSTGNIMLWRIRCTDKD
100110120130140150160170180190
DFQSNELDIHAIANLQLFEKDVLIASCHFSPLDCKKLLVTNTAGEAATIDIRTLSVQFTASAIAQAYSKLDKIDYEVQGATEKVIHVESGQFLKPHELEC
200210220230240250260270280290
WTAEFGSLQPFQDVVFTGGDDSRIMAHDLRSKEFIWSNNRIHDAGVVSIKCSQPNFRNNKPTSIITGSYDDNIRSLDLRMMGESIFPGANVPTVNKLACD
1
300310320330340350360370380
LGGGVWRFVESPIDQEQSHHNGSDRLLVCCMYNGAKVVTMNDNSDEYFQIQHYLKKGHDSMCYGGDWSNSLIATCSFYDNSLQTWIV
Peptide Filter:(SeqId = 279844)
Peptide Sort:
Peptide Counts:1 total, 1 distinct
10392+17.50015.0000.00012.0000.60033%1078.5830-1.25800.2324K.CSQPNFR.N1UPSP:YB96_YEAST