UPSP:MS116_YEAST (MSS116)

demo
RunMM_clICAT12.pep.xml (Peroxisomal_ICAT/MM_clICAT12 (Native_Yeast_ICAT))
Sequence Mass76,269 
AA Coverage2% (13 / 664)
Mass Coverage2% (1,370 / 76,269)
Peptides?
0102030405060708090
MLTSILIKGRTPVLASRNLLAALSNCNHITWAVSRRLYNDGNRDQRNFGRNQRNNNSNRYRNSRFNSRPRTRSREDDDEVHFDKTTFSKLIHVPKEDNSK
100110120130140150160170180190
EVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEV
200210220230240250260270280290
KKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIK
1 / 1(C')
300310320330340350360370380390
TLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKD
400410420430440450460470480490
LPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIA
500510520530540550560570580590
KQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRDYSSR
600610620630640650660
DGNNKSYDYDDDSEISFRGNKNYNNRSQNRDYDDEPFRRSNNNRRSFSRSNDKNNYSSRNSNIY
Peptide Filter:(SeqId = 280469)
Peptide Sort:
Peptide Counts:1 total, 1 distinct
9692+18.20016.5009.10010.9003.60025%1623.8670+1.42200.1380K.YAC'VSLVGGTDFR.A1UPSP:MS116_YEAST