UPSP:DHSB_YEAST (SDH2)

demo
RunMM_clICAT12.pep.xml (Peroxisomal_ICAT/MM_clICAT12 (Native_Yeast_ICAT))
Sequence Mass30,231 
AA Coverage3% (8 / 266)
Mass Coverage3% (847 / 30,231)
Peptides?
0102030405060708090
MLNVLLRRKAFCLVTKKGMATATTAAATHTPRLKTFKVYRWNPDEPSAKPHLQSYQVDLNDCGPMVLDALLKIKDEQDSTLTFRRSCREGICGSCAMNIG
100110120130140150160170180190
GRNTLACICKIDQNESKQLKIYPLPHMFIVKDLVPDLTNFYQQYKSIQPYLQRSSFPKDGTEVLQSIEDRKKLDGLYECILCACCSTSCPSYWWNQEQYL
1 / 1(C')
200210220230240250260
GPAVLMQAYRWLIDSRDQATKTRKAMLNNSMSLYRCHTIMNCTRTCPKGLNPGLAIAEIKKSLAFA
Peptide Filter:(SeqId = 284815)
Peptide Sort:
Peptide Counts:1 total, 1 distinct
12041+20.00013.3000.0008.6000.02543%1337.8270+0.40000.9999R.NTLAC'IC'K.I1UPSP:DHSB_YEAST