UPSP:RNA12_YEAST (RNA12)

demo
RunMM_clICAT12.pep.xml (Peroxisomal_ICAT/MM_clICAT12 (Native_Yeast_ICAT))
Sequence Mass96,689 
AA Coverage1% (8 / 850)
Mass Coverage1% (868 / 96,689)
Peptides?
0102030405060708090
MLLVRTTSLNVSRMPVPCLARGIGILKGKYRLANLMNAQPSVRHVSSEIQQKDQQAGESNTATDTGVIHKSDEETLIYFDNVYARTTSVWNPTLWYNLLL
1
100110120130140150160170180190
RNQSRDAVREKIRNLASPPNNPIYGLELKSTIPVKRDGGVFATFVVPPKYTKAQVNSLIQQNTARESSKNLLSYFTRASAFPVKGSPWIEDLRRLPSTTI
200210220230240250260270280290
VIKFQGPALTEEEIYSLFRRYGTIIDIFPPTAANNNVAKVRYRSFRGAISAKNCVSGIEIHNTVLHIQYENIRRGHLVSNFFTNHTRIAIPVLFALLSIF
300310320330340350360370380390
AVLVFDPIREFSIEQKITHKYSLSWDNKFWKQLKTLTSSTMTSIKYYWGGPDDNHQRKHLWEERIEKVNDLKMWLEENNNTFVVIRGPRGSGKHDLVMQH
400410420430440450460470480490
TLQNRANVLYLDCDKLIKSRTDPMFLKNAASQLGYFPIFPWIDSVTGVLDLTVQGLTGQKTGLSETKESRFRNMLTTSLMSIRRIALKNYKAFVSTGDGT
500510520530540550560570580590
VNVKEEDYLQQHPEAKPVIVIDRFEGKSEINGFVYKELSDWAAMLVQMNIAHVIFLTETVASNQRLSESLPNQVFKNLILSDASKENSRNYVLSQLEDYL
600610620630640650660670680690
YYNKKSKGENVKEPESEKETAENNDSDSEADTSVKKAEVILNEKELQEIDASLEPLGGRMLDLQAFVRRVKSGEEPSEAVDKMIEQASEQITQMFLSDKI
700710720730740750760770780790
DSNKSAQAWELIELLSANPVIPFHEIVNKPLFKAAPETGIMELENNGLITVSRDRGVLQEIRPAKPLYRAAFTYLINDPELAKVLKTRYLLKVVGFETGR
800810820830840
IKKWEEELKPLGKVPDQKLFKTRLDYLSGKINASNAVITKCEEEIKNLSK
Peptide Filter:(SeqId = 285131)
Peptide Sort:
Peptide Counts:1 total, 1 distinct
17061+14.00013.8004.90010.9004.50029%1113.6640+0.32800.8818R.MPVPCLAR.G1UPSP:RNA12_YEAST